PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.C01283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 450aa    MW: 48315.6 Da    PI: 4.1518
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.C01283.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF39.57.3e-131450541
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE- CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevaviifs 41
                    +k  rq +f kRr +++ KA  LS+LC++ +avi+++
  Pahal.C01283.1 14 EKGVRQASFRKRRGTLFDKARDLSILCQIPAAVIVYG 50
                    67789*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-13161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-17594IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.722550IPR002100Transcription factor, MADS-box
CDDcd002662.21E-18686No hitNo description
PfamPF003197.1E-111550IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 450 aa     Download sequence    Send to blast
MPRAGKVKIQ WIMEKGVRQA SFRKRRGTLF DKARDLSILC QIPAAVIVYG GGEAEPQVWP  60
GVQEVTEILR RYRDLPDSLK EARRLDNEGF VRRRTQKMKR KLDNCRASAS RLEVNLILND  120
ISLGRPREFA DLPRELTGAV VSALDALRSV TADRVNFLRS EAAQAAALPQ QLLEEAVAAA  180
LMALQEPPMV PPAVAMAPPM VANAPLLLPA LEPEPPMVPP LAMAPVVADA PLLMPVPEPE  240
PPMVPPLAMA PVLADASLLL PAPEPEQPMV PPLAMAPVLA DVPLDLLLLL LLLPEPEPEP  300
VPPQSELVVA LAPPPQEPPM VADAPLLLPA PEPEPPMMLL DLLLLPEPEP ELVPPQSDEL  360
VVAPAPEPQE PPMVADASLL LPAAGPEPPA TAAGAVVDEP LNLYAEPRDG SFLLEMADAI  420
MDDGSGRQAT AEDVDRLLRE YGLESFKPM*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440555.16e-54hypothetical protein SORBIDRAFT_09g003030
TrEMBLK3ZDZ11e-153K3ZDZ1_SETIT; Uncharacterized protein
STRINGSi024783m1e-153(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2104367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.26e-16M-type_MADS family protein